Lineage for d2at0x_ (2at0 X:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804617Protein Nitrophorin 4 [50845] (1 species)
  7. 2804618Species Rhodnius prolixus [TaxId:13249] [50846] (49 PDB entries)
    Uniprot Q94734 22-205
  8. 2804626Domain d2at0x_: 2at0 X: [146069]
    automated match to d1d2ua_
    complexed with hem, no, po4; mutant

Details for d2at0x_

PDB Entry: 2at0 (more details), 1 Å

PDB Description: 1.00 a crystal structure of l133v mutant of nitrophorin 4 from rhodnius prolixus complexed with nitric oxide at ph 5.6
PDB Compounds: (X:) Nitrophorin 4

SCOPe Domain Sequences for d2at0x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2at0x_ b.60.1.1 (X:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdvyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOPe Domain Coordinates for d2at0x_:

Click to download the PDB-style file with coordinates for d2at0x_.
(The format of our PDB-style files is described here.)

Timeline for d2at0x_: