| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.274: HAMP domain-like [158471] (1 superfamily) dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections |
Superfamily a.274.1: HAMP domain-like [158472] (1 family) ![]() |
| Family a.274.1.1: HAMP domain [158473] (1 protein) Pfam PF00672 |
| Protein Hypothetical protein AF1503 [158474] (1 species) C-terminal domain |
| Species Archaeoglobus fulgidus [TaxId:2234] [158475] (2 PDB entries) Uniprot O28769 278-331 |
| Domain d2aswa1: 2asw A:278-331 [146065] |
PDB Entry: 2asw (more details)
SCOP Domain Sequences for d2aswa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aswa1 a.274.1.1 (A:278-331) Hypothetical protein AF1503 {Archaeoglobus fulgidus [TaxId: 2234]}
stitrpiielsntadkiaegnleaevphqnradeigilaksierlrrslkvame
Timeline for d2aswa1: