![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.3: LplA-like [143642] (6 proteins) part of Pfam PF03099 |
![]() | Protein Lipoate-protein ligase A [160604] (2 species) |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [160606] (3 PDB entries) Uniprot Q9HKT1 1-257 |
![]() | Domain d2arta_: 2art A: [146063] automated match to d2arsa1 complexed with amp, lpa, mg |
PDB Entry: 2art (more details), 2.4 Å
SCOPe Domain Sequences for d2arta_:
Sequence, based on SEQRES records: (download)
>d2arta_ d.104.1.3 (A:) Lipoate-protein ligase A {Thermoplasma acidophilum [TaxId: 2303]} megrlllletpgntrmslaydeaiyrsfqygdkpilrfyrhdrsviigyfqvaeeevdld ymkkngimlarrytgggavyhdlgdlnfsvvrssddmditsmfrtmneavvnslrilgld arpgelndvsipvnkktdimagekkimgaagamrkgaklwhaamlvhtdldmlsavlkvp dekfrdkiakstrervanvtdfvdvsidevrnalirgfsetlhidfredtitekeeslar elfdkkysteewnmgll
>d2arta_ d.104.1.3 (A:) Lipoate-protein ligase A {Thermoplasma acidophilum [TaxId: 2303]} megrlllletpgntrmslaydeaiyrsfqygdkpilrfyrhdrsviigyfqvaeeevdld ymkkngimlarrytgggavyhdlgdlnfsvvrssddmditsmfrtmneavvnslrilgld arpgelndvsipvnkktdimagekkimgaagamrkgaklwhaamlvhtdldmlsavlkvp strervanvtdfvdvsidevrnalirgfsetlhidfredtitekeeslarelfdkkyste ewnmgll
Timeline for d2arta_: