![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) ![]() duplication: contains two subdomains of this fold |
![]() | Family d.58.36.1: Duplicated SiR/NiR-like domains 1 and 3 [55125] (5 proteins) |
![]() | Protein Ferredoxin-nitrite reductase, NIR, C-terminal domain [419045] (1 species) |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [419532] (1 PDB entry) Uniprot P05314 |
![]() | Domain d2akja1: 2akj A:346-430 [146057] Other proteins in same PDB: d2akja2, d2akja3, d2akja4 complexed with sf4, srm |
PDB Entry: 2akj (more details), 2.8 Å
SCOPe Domain Sequences for d2akja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2akja1 d.58.36.1 (A:346-430) Ferredoxin-nitrite reductase, NIR, C-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]} kdwerreylgvhpqkqqglsfvglhipvgrlqademeelariadvygsgelrltveqnii ipnvenskidsllnepllkeryspe
Timeline for d2akja1: