Lineage for d2akja1 (2akj A:346-430)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955424Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955425Family d.58.36.1: Duplicated SiR/NiR-like domains 1 and 3 [55125] (5 proteins)
  6. 2955426Protein Ferredoxin-nitrite reductase, NIR, C-terminal domain [419045] (1 species)
  7. 2955427Species Spinach (Spinacia oleracea) [TaxId:3562] [419532] (1 PDB entry)
    Uniprot P05314
  8. 2955428Domain d2akja1: 2akj A:346-430 [146057]
    Other proteins in same PDB: d2akja2, d2akja3, d2akja4
    complexed with sf4, srm

Details for d2akja1

PDB Entry: 2akj (more details), 2.8 Å

PDB Description: structure of spinach nitrite reductase
PDB Compounds: (A:) Ferredoxin--nitrite reductase, chloroplast

SCOPe Domain Sequences for d2akja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akja1 d.58.36.1 (A:346-430) Ferredoxin-nitrite reductase, NIR, C-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]}
kdwerreylgvhpqkqqglsfvglhipvgrlqademeelariadvygsgelrltveqnii
ipnvenskidsllnepllkeryspe

SCOPe Domain Coordinates for d2akja1:

Click to download the PDB-style file with coordinates for d2akja1.
(The format of our PDB-style files is described here.)

Timeline for d2akja1: