SCOPe 2.02: Domain d2aifa1: 2aif A:16-130

Lineage for d2aifa1 (2aif A:16-130)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Cryptosporidium parvum [TaxId:5807] [160503] (1 PDB entry)
   Uniprot Q7YYQ3 17-131

8. Domain d2aifa1: 2aif A:16-130 [146055]

Details for d2aifa1

PDB Entry: 2aif, 1.9 Å

PDB Description: crystal structure of high mobility like protein, nhp2, putative from cryptosporidium parvum

PDB Compounds: (A:) ribosomal protein L7A

SCOPe Domain Sequences for d2aifa1:

Sequence; same for both SEQRES and ATOM records:

>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]}
fplaspdlnnkiinlvqqacnykqlrkganeatkalnrgiaeivllaadaepleillhlp
lvcedkntpyvfvrskvalgracgvsrpviaaaitskdgsslssqitelkdqieq

Timeline for d2aifa1:

• d2aifa1 first appeared in SCOP 1.75
  
• d2aifa1 appears in SCOPe 2.01
  
• d2aifa1 appears in SCOPe 2.03
  
• d2aifa1 appears in the current release, SCOPe 2.08