![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins) similar dimer to the class I KARI |
![]() | Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species) |
![]() | Species Neisseria meningitidis, serogroup B [TaxId:487] [116986] (3 PDB entries) Uniprot Q9K1N1 |
![]() | Domain d2ag8a1: 2ag8 A:153-263 [146053] Other proteins in same PDB: d2ag8a2 automated match to d1yqga1 complexed with nap |
PDB Entry: 2ag8 (more details), 2.1 Å
SCOPe Domain Sequences for d2ag8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ag8a1 a.100.1.10 (A:153-263) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} deekmhgitgisgsgpayvfylldalqnaairqgfdmaearalslatfkgavalaeqtge dfeklqknvtskggttheaveafrrhrvaeaisegvcacvrrsqemerqyq
Timeline for d2ag8a1: