Lineage for d2ag8a1 (2ag8 A:153-263)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721489Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins)
    similar dimer to the class I KARI
  6. 2721493Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species)
  7. 2721494Species Neisseria meningitidis, serogroup B [TaxId:487] [116986] (3 PDB entries)
    Uniprot Q9K1N1
  8. 2721497Domain d2ag8a1: 2ag8 A:153-263 [146053]
    Other proteins in same PDB: d2ag8a2
    automated match to d1yqga1
    complexed with nap

Details for d2ag8a1

PDB Entry: 2ag8 (more details), 2.1 Å

PDB Description: NADP complex of Pyrroline-5-carboxylate reductase from Neisseria meningitidis
PDB Compounds: (A:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d2ag8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ag8a1 a.100.1.10 (A:153-263) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]}
deekmhgitgisgsgpayvfylldalqnaairqgfdmaearalslatfkgavalaeqtge
dfeklqknvtskggttheaveafrrhrvaeaisegvcacvrrsqemerqyq

SCOPe Domain Coordinates for d2ag8a1:

Click to download the PDB-style file with coordinates for d2ag8a1.
(The format of our PDB-style files is described here.)

Timeline for d2ag8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ag8a2