Lineage for d2acwb_ (2acw B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2910991Family c.87.1.10: UDPGT-like [159785] (5 proteins)
    Pfam PF00201
  6. 2911009Protein automated matches [190473] (3 species)
    not a true protein
  7. 2911013Species Medicago truncatula [TaxId:3880] [187393] (1 PDB entry)
  8. 2911014Domain d2acwb_: 2acw B: [146050]
    Other proteins in same PDB: d2acwa1
    automated match to d2acva1
    complexed with upg

Details for d2acwb_

PDB Entry: 2acw (more details), 2.6 Å

PDB Description: Crystal Structure of Medicago truncatula UGT71G1 complexed with UDP-glucose
PDB Compounds: (B:) triterpene UDP-glucosyl transferase UGT71G1

SCOPe Domain Sequences for d2acwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2acwb_ c.87.1.10 (B:) automated matches {Medicago truncatula [TaxId: 3880]}
knselifipapgighlasalefaklltnhdknlyitvfcikfpgmpfadsyiksvlasqp
qiqlidlpevepppqellkspefyiltflesliphvkatiktilsnkvvglvldffcvsm
idvgnefgipsylfltsnvgflslmlslknrqieevfddsdrdhqllnipgisnqvpsnv
lpdacfnkdggyiayyklaerfrdtkgiivntfsdleqssidalydhdekippiyavgpl
ldlkgqpnpkldqaqhdlilkwldeqpdksvvflcfgsmgvsfgpsqireialglkhsgv
rflwsnsaekkvfpegflewmelegkgmicgwapqvevlahkaiggfvshcgwnsilesm
wfgvpiltwpiyaeqqlnafrlvkewgvglglrvdyrkgsdvvaaeeiekglkdlmdkds
ivhkkvqemkemsrnavvdggsslisvgklidditg

SCOPe Domain Coordinates for d2acwb_:

Click to download the PDB-style file with coordinates for d2acwb_.
(The format of our PDB-style files is described here.)

Timeline for d2acwb_: