Lineage for d2acwa1 (2acw A:3-463)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 845255Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 845256Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (11 families) (S)
  5. 845547Family c.87.1.10: UDPGT-like [159785] (4 proteins)
    Pfam PF00201
  6. 845556Protein Triterpene UDP-glucosyl transferase UGT71G1 [159788] (1 species)
  7. 845557Species Medicago truncatula [TaxId:3880] [159789] (2 PDB entries)
    Uniprot Q5IFH7 3-463
  8. 845560Domain d2acwa1: 2acw A:3-463 [146049]
    complexed with upg

Details for d2acwa1

PDB Entry: 2acw (more details), 2.6 Å

PDB Description: Crystal Structure of Medicago truncatula UGT71G1 complexed with UDP-glucose
PDB Compounds: (A:) triterpene UDP-glucosyl transferase UGT71G1

SCOP Domain Sequences for d2acwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2acwa1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]}
msdinknselifipapgighlasalefaklltnhdknlyitvfcikfpgmpfadsyiksv
lasqpqiqlidlpevepppqellkspefyiltflesliphvkatiktilsnkvvglvldf
fcvsmidvgnefgipsylfltsnvgflslmlslknrqieevfddsdrdhqllnipgisnq
vpsnvlpdacfnkdggyiayyklaerfrdtkgiivntfsdleqssidalydhdekippiy
avgplldlkgqpnpkldqaqhdlilkwldeqpdksvvflcfgsmgvsfgpsqireialgl
khsgvrflwsnsaekkvfpegflewmelegkgmicgwapqvevlahkaiggfvshcgwns
ilesmwfgvpiltwpiyaeqqlnafrlvkewgvglglrvdyrkgsdvvaaeeiekglkdl
mdkdsivhkkvqemkemsrnavvdggsslisvgklidditg

SCOP Domain Coordinates for d2acwa1:

Click to download the PDB-style file with coordinates for d2acwa1.
(The format of our PDB-style files is described here.)

Timeline for d2acwa1: