SCOPe 2.08: Domain d2aarw1: 2aar W:2-66

Lineage for d2aarw1 (2aar W:2-66)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)
   automatically mapped to Pfam PF00831

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [158220] (8 PDB entries)
   Uniprot Q9RXJ4 1-66

8. Domain d2aarw1: 2aar W:2-66 [146044]
   Other proteins in same PDB: d2aarr1
   automatically matched to 2ZJR V:1-66

Details for d2aarw1

PDB Entry: 2aar

PDB Description: structure of trigger factor binding domain in biologically homologous complex with eubacterial ribosome.

PDB Compounds: (W:) 50S ribosomal protein L29

SCOPe Domain Sequences for d2aarw1:

Sequence; same for both SEQRES and ATOM records:

>d2aarw1 a.2.2.1 (W:2-66) Ribosomal protein L29 (L29p) {Deinococcus radiodurans [TaxId: 1299]}
kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela
rkgeq

Timeline for d2aarw1:

• d2aarw1 first appeared in SCOP 1.75
  
• d2aarw1 appears in SCOPe 2.07