Lineage for d2aarr1 (2aar R:2-94)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929542Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2929543Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2929544Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 2929545Protein Ribosomal protein L23 [54191] (4 species)
  7. 2929546Species Deinococcus radiodurans [TaxId:1299] [159877] (8 PDB entries)
    Uniprot Q9RXK0 2-94
  8. 2929554Domain d2aarr1: 2aar R:2-94 [146043]
    Other proteins in same PDB: d2aarw1
    automatically matched to 2ZJR Q:2-94

Details for d2aarr1

PDB Entry: 2aar (more details)

PDB Description: structure of trigger factor binding domain in biologically homologous complex with eubacterial ribosome.
PDB Compounds: (R:) 50S ribosomal protein L23

SCOPe Domain Sequences for d2aarr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aarr1 d.12.1.1 (R:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]}
shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
rkrvgrfigqrndrkkaivrlaegqsiealagq

SCOPe Domain Coordinates for d2aarr1:

Click to download the PDB-style file with coordinates for d2aarr1.
(The format of our PDB-style files is described here.)

Timeline for d2aarr1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2aarw1