SCOPe 2.08: Domain d2aarr1: 2aar R:2-94

Lineage for d2aarr1 (2aar R:2-94)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)
   automatically mapped to Pfam PF00276

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159877] (8 PDB entries)
   Uniprot Q9RXK0 2-94

8. Domain d2aarr1: 2aar R:2-94 [146043]
   Other proteins in same PDB: d2aarw1
   automatically matched to 2ZJR Q:2-94

Details for d2aarr1

PDB Entry: 2aar

PDB Description: structure of trigger factor binding domain in biologically homologous complex with eubacterial ribosome.

PDB Compounds: (R:) 50S ribosomal protein L23

SCOPe Domain Sequences for d2aarr1:

Sequence; same for both SEQRES and ATOM records:

>d2aarr1 d.12.1.1 (R:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]}
shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
rkrvgrfigqrndrkkaivrlaegqsiealagq

Timeline for d2aarr1:

• d2aarr1 first appeared in SCOP 1.75
  
• d2aarr1 appears in SCOPe 2.07