SCOPe 2.08: Domain d2a90a2: 2a90 A:132-211

Lineage for d2a90a2 (2a90 A:132-211)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.289: WWE domain [117838] (1 superfamily)
   beta(2)-alpha-beta(4); antiparallel folded beta-sheet (half-barrel), order 216543

4. Superfamily d.289.1: WWE domain [117839] (1 family)

5. Family d.289.1.1: WWE domain [117840] (3 proteins)
   Pfam PF02825

6. Protein Deltex (Dx) [159945] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [159946] (1 PDB entry)
   Uniprot Q23985 132-211! Uniprot Q23985 43-131

8. Domain d2a90a2: 2a90 A:132-211 [146042]

Details for d2a90a2

PDB Entry: 2a90, 2.15 Å

PDB Description: Crystal Structure of the tandem WWE domain of Drosophila Deltex

PDB Compounds: (A:) Deltex protein

SCOPe Domain Sequences for d2a90a2:

Sequence; same for both SEQRES and ATOM records:

>d2a90a2 d.289.1.1 (A:132-211) Deltex (Dx) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kwewsggsadsnndwrpynmhvqsiiedawargeqtldlsnthiglpytinfsnltqlrq
psgpmrsirrtqqapyplvk

Timeline for d2a90a2:

• d2a90a2 first appeared in SCOP 1.75
  
• d2a90a2 appears in SCOPe 2.07