Lineage for d2a90a1 (2a90 A:43-131)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009877Fold d.289: WWE domain [117838] (1 superfamily)
    beta(2)-alpha-beta(4); antiparallel folded beta-sheet (half-barrel), order 216543
  4. 3009878Superfamily d.289.1: WWE domain [117839] (1 family) (S)
  5. 3009879Family d.289.1.1: WWE domain [117840] (3 proteins)
    Pfam PF02825
  6. 3009880Protein Deltex (Dx) [159945] (1 species)
  7. 3009881Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [159946] (1 PDB entry)
    Uniprot Q23985 132-211! Uniprot Q23985 43-131
  8. 3009882Domain d2a90a1: 2a90 A:43-131 [146041]

Details for d2a90a1

PDB Entry: 2a90 (more details), 2.15 Å

PDB Description: Crystal Structure of the tandem WWE domain of Drosophila Deltex
PDB Compounds: (A:) Deltex protein

SCOPe Domain Sequences for d2a90a1:

Sequence, based on SEQRES records: (download)

>d2a90a1 d.289.1.1 (A:43-131) Deltex (Dx) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ahavsvwefesrgkwlpyspavsqhlerahakkltrvmlsdadpsleqyyvnvrtmtqes
eaetagsglltigvrrmfyapsspagkgt

Sequence, based on observed residues (ATOM records): (download)

>d2a90a1 d.289.1.1 (A:43-131) Deltex (Dx) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ahavsvwefesrgkwlpyspavsqhlerahakkltrvmlsdadpsleqyyvnvrtmtqes
ltigvrrmfyapsspagkgt

SCOPe Domain Coordinates for d2a90a1:

Click to download the PDB-style file with coordinates for d2a90a1.
(The format of our PDB-style files is described here.)

Timeline for d2a90a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a90a2