Lineage for d2a1kb_ (2a1k B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383674Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 protein domains)
    barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms
  6. 2383711Protein automated matches [190382] (1 species)
    not a true protein
  7. 2383712Species Enterobacteria phage [TaxId:12353] [187231] (1 PDB entry)
  8. 2383714Domain d2a1kb_: 2a1k B: [146039]
    automated match to d1gpca_
    complexed with zn

Details for d2a1kb_

PDB Entry: 2a1k (more details), 2 Å

PDB Description: RB69 single-stranded DNA binding protein core domain
PDB Compounds: (B:) gp32 single stranded DNA binding protein

SCOPe Domain Sequences for d2a1kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1kb_ b.40.4.7 (B:) automated matches {Enterobacteria phage [TaxId: 12353]}
gewklkldasgngqavirflpaktddalpfailvnhgfkkngkwyietcssthgdydscp
vcqyiskndlyntnkteysqlkrktsywanilvvkdpqapdnegkvfkyrfgkkiwdkin
amiavdtemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipniddesfqke
lfeqmvdlsemtskdkfksfeelntkfnqvlg

SCOPe Domain Coordinates for d2a1kb_:

Click to download the PDB-style file with coordinates for d2a1kb_.
(The format of our PDB-style files is described here.)

Timeline for d2a1kb_: