![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins) barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms |
![]() | Protein automated matches [190382] (1 species) not a true protein |
![]() | Species Enterobacteria phage [TaxId:12353] [187231] (1 PDB entry) |
![]() | Domain d2a1ka_: 2a1k A: [146038] automated match to d1gpca_ complexed with zn |
PDB Entry: 2a1k (more details), 2 Å
SCOPe Domain Sequences for d2a1ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1ka_ b.40.4.7 (A:) automated matches {Enterobacteria phage [TaxId: 12353]} dkgewklkldasgngqavirflpaktddalpfailvnhgfkkngkwyietcssthgdyds cpvcqyiskndlyntnkteysqlkrktsywanilvvkdpqapdnegkvfkyrfgkkiwdk inamiavdtemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipniddesfq kelfeqmvdlsemtskdkfksfeelntkfnqvlgt
Timeline for d2a1ka_: