Lineage for d2a0ub_ (2a0u B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151171Family c.124.1.5: IF2B-like [110513] (5 protein domains)
    Pfam PF01008; contains extra N-terminal alpha+beta domain (1-126); beta(3)-alpha(5); 3 layers: b/a/a
  6. 2151172Protein Initiation factor 2b [159543] (1 species)
  7. 2151173Species Leishmania major [TaxId:5664] [159544] (1 PDB entry)
    Uniprot Q4Q0R9 133-506,133-506
  8. 2151175Domain d2a0ub_: 2a0u B: [146037]
    automated match to d2a0ua1
    complexed with so4

Details for d2a0ub_

PDB Entry: 2a0u (more details), 2.1 Å

PDB Description: Crystal structure of the eukaryotic initiation factor 2B from Leishmania major at 2.1 A resolution
PDB Compounds: (B:) initiation factor 2B

SCOPe Domain Sequences for d2a0ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a0ub_ c.124.1.5 (B:) Initiation factor 2b {Leishmania major [TaxId: 5664]}
tlesikytpgslrlldqrklpletvfddvltvediwsaikemrvrgapaiavsaalgiav
atqrkaangelksgrevqtflltscdfvmtsrptavnlfnclrdlkaqvdkldptkaaae
vaqafvelaeavytndvafnegimrhgaahilaaakaegrdkvsilticntgalatsryg
talgvvrqlfydgklervyacetrpwnqgarltvyecvqedipctlicdgaasslmlnrk
idavvvgadricqngdtankigtynlavsakfhgvklyvaaptttldvktasgnhveiee
repteittnlvtkqrvvadgphlsiwnpvfditpselitggiitekgvqapaasapyydi
asiiaqa

SCOPe Domain Coordinates for d2a0ub_:

Click to download the PDB-style file with coordinates for d2a0ub_.
(The format of our PDB-style files is described here.)

Timeline for d2a0ub_: