Lineage for d1zyla1 (1zyl A:4-328)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586169Family d.144.1.6: APH phosphotransferases [64411] (5 proteins)
  6. 2586191Protein RdoA [160818] (1 species)
    Hypothetical protein YihE
  7. 2586192Species Escherichia coli [TaxId:562] [160819] (1 PDB entry)
    Uniprot P0C0K3 4-328
  8. 2586193Domain d1zyla1: 1zyl A:4-328 [146035]

Details for d1zyla1

PDB Entry: 1zyl (more details), 2.8 Å

PDB Description: Crystal Structure of Hypothetical Protein YihE from Escherichia coli
PDB Compounds: (A:) Hypothetical protein yihE

SCOPe Domain Sequences for d1zyla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]}
saftfqtlhpdtimdalfehgirvdsgltplnsyenrvyqfqdedrrrfvvkfyrperwt
adqileehqfalqlvndevpvaapvafngqtllnhqgfyfavfpsvggrqfeadnidqme
avgrylgrmhqtgrkqlfihrptiglneylieprklfedatlipsglkaaflkatdelia
avtahwredftvlrlhgdchagnilwrdgpmfvdlddarngpavqdlwmllngdkaeqrm
qletiieayeefsefdtaeiglieplramrlvyylawlmrrwadpafpknfpwltgedyw
lrqtatfieqakvlqepplqltpmy

SCOPe Domain Coordinates for d1zyla1:

Click to download the PDB-style file with coordinates for d1zyla1.
(The format of our PDB-style files is described here.)

Timeline for d1zyla1: