SCOPe 2.07: Domain d1zyla1: 1zyl A:4-328

Lineage for d1zyla1 (1zyl A:4-328)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.6: APH phosphotransferases [64411] (5 proteins)

6. Protein RdoA [160818] (1 species)
   Hypothetical protein YihE

7. Species Escherichia coli [TaxId:562] [160819] (1 PDB entry)
   Uniprot P0C0K3 4-328

8. Domain d1zyla1: 1zyl A:4-328 [146035]

Details for d1zyla1

PDB Entry: 1zyl, 2.8 Å

PDB Description: Crystal Structure of Hypothetical Protein YihE from Escherichia coli

PDB Compounds: (A:) Hypothetical protein yihE

SCOPe Domain Sequences for d1zyla1:

Sequence; same for both SEQRES and ATOM records:

>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]}
saftfqtlhpdtimdalfehgirvdsgltplnsyenrvyqfqdedrrrfvvkfyrperwt
adqileehqfalqlvndevpvaapvafngqtllnhqgfyfavfpsvggrqfeadnidqme
avgrylgrmhqtgrkqlfihrptiglneylieprklfedatlipsglkaaflkatdelia
avtahwredftvlrlhgdchagnilwrdgpmfvdlddarngpavqdlwmllngdkaeqrm
qletiieayeefsefdtaeiglieplramrlvyylawlmrrwadpafpknfpwltgedyw
lrqtatfieqakvlqepplqltpmy

Timeline for d1zyla1:

• d1zyla1 first appeared in SCOP 1.75
  
• d1zyla1 appears in SCOPe 2.06
  
• d1zyla1 appears in the current release, SCOPe 2.08