Lineage for d1zx2b_ (1zx2 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181455Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2181479Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 2181541Protein UBP3-associated protein BRE5 [159959] (1 species)
  7. 2181542Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159960] (2 PDB entries)
    Uniprot P53741 1-141
  8. 2181546Domain d1zx2b_: 1zx2 B: [146034]
    Other proteins in same PDB: d1zx2a2
    automated match to d1zx2a1

Details for d1zx2b_

PDB Entry: 1zx2 (more details), 2.1 Å

PDB Description: Crystal Structure of Yeast UBP3-associated Protein BRE5
PDB Compounds: (B:) UBP3-associated protein BRE5

SCOPe Domain Sequences for d1zx2b_:

Sequence, based on SEQRES records: (download)

>d1zx2b_ d.17.4.2 (B:) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gvtvqdicfaflqnyyermrtdpsklayfyastaelthtnyqskstnekddvlptvkvtg
reninkffsrndakvrslklkldtidfqytghlhksilimatgemfwtgtpvykfcqtfi
llpssngstfditndiirfisn

Sequence, based on observed residues (ATOM records): (download)

>d1zx2b_ d.17.4.2 (B:) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gvtvqdicfaflqnyyermrtdpsklayfyastaelthtnyptvkvtgreninkffsrnd
akvrslklkldtidfqytghlhksilimatgemfwtgtpvykfcqtfillpssngstfdi
tndiirfisn

SCOPe Domain Coordinates for d1zx2b_:

Click to download the PDB-style file with coordinates for d1zx2b_.
(The format of our PDB-style files is described here.)

Timeline for d1zx2b_: