SCOPe 2.06: Domain d1zx2b_: 1zx2 B:

Lineage for d1zx2b_ (1zx2 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (6 proteins)

6. Protein UBP3-associated protein BRE5 [159959] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159960] (2 PDB entries)
   Uniprot P53741 1-141

8. Domain d1zx2b_: 1zx2 B: [146034]
   Other proteins in same PDB: d1zx2a2
   automated match to d1zx2a1

Details for d1zx2b_

PDB Entry: 1zx2, 2.1 Å

PDB Description: Crystal Structure of Yeast UBP3-associated Protein BRE5

PDB Compounds: (B:) UBP3-associated protein BRE5

SCOPe Domain Sequences for d1zx2b_:

Sequence, based on SEQRES records:

>d1zx2b_ d.17.4.2 (B:) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gvtvqdicfaflqnyyermrtdpsklayfyastaelthtnyqskstnekddvlptvkvtg
reninkffsrndakvrslklkldtidfqytghlhksilimatgemfwtgtpvykfcqtfi
llpssngstfditndiirfisn

Sequence, based on observed residues (ATOM records):

>d1zx2b_ d.17.4.2 (B:) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gvtvqdicfaflqnyyermrtdpsklayfyastaelthtnyptvkvtgreninkffsrnd
akvrslklkldtidfqytghlhksilimatgemfwtgtpvykfcqtfillpssngstfdi
tndiirfisn

Timeline for d1zx2b_:

• d1zx2b_ first appeared in SCOP 1.75, called d1zx2b1
  
• d1zx2b_ appears in SCOPe 2.05
  
• d1zx2b_ appears in SCOPe 2.07
  
• d1zx2b_ appears in the current release, SCOPe 2.08