Lineage for d1zx2a1 (1zx2 A:1-141)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2505384Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 2505446Protein UBP3-associated protein BRE5 [159959] (1 species)
  7. 2505447Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159960] (2 PDB entries)
    Uniprot P53741 1-141
  8. 2505450Domain d1zx2a1: 1zx2 A:1-141 [146033]
    Other proteins in same PDB: d1zx2a2

Details for d1zx2a1

PDB Entry: 1zx2 (more details), 2.1 Å

PDB Description: Crystal Structure of Yeast UBP3-associated Protein BRE5
PDB Compounds: (A:) UBP3-associated protein BRE5

SCOPe Domain Sequences for d1zx2a1:

Sequence, based on SEQRES records: (download)

>d1zx2a1 d.17.4.2 (A:1-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mgvtvqdicfaflqnyyermrtdpsklayfyastaelthtnyqskstnekddvlptvkvt
greninkffsrndakvrslklkldtidfqytghlhksilimatgemfwtgtpvykfcqtf
illpssngstfditndiirfi

Sequence, based on observed residues (ATOM records): (download)

>d1zx2a1 d.17.4.2 (A:1-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mgvtvqdicfaflqnyyermrtdpsklayfyastaelthtnyptvkvtgreninkffsrn
dakvrslklkldtidfqytghlhksilimatgemfwtgtpvykfcqtfillpssngstfd
itndiirfi

SCOPe Domain Coordinates for d1zx2a1:

Click to download the PDB-style file with coordinates for d1zx2a1.
(The format of our PDB-style files is described here.)

Timeline for d1zx2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zx2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1zx2b_