Lineage for d1zvfb1 (1zvf B:1-171)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 810149Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (1 protein)
    Pfam PF06052; 3-HAO
  6. 810150Protein 3-hydroxyanthranilate-3,4-dioxygenase [141619] (2 species)
  7. 810151Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159292] (1 PDB entry)
    Uniprot P47096 1-175
  8. 810153Domain d1zvfb1: 1zvf B:1-171 [146030]
    automatically matched to 1ZVF A:1-175
    complexed with ni

Details for d1zvfb1

PDB Entry: 1zvf (more details), 2.41 Å

PDB Description: the crystal structure of 3-hydroxyanthranilate 3,4-dioxygenase from saccharomyces cerevisiae
PDB Compounds: (B:) 3-hydroxyanthranilate 3,4-dioxygenase

SCOP Domain Sequences for d1zvfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvfb1 b.82.1.20 (B:1-171) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mfnttpinidkwlkenegllkppvnnyclhkggftvmivggpnertdyhinptpewfyqk
kgsmllkvvdetdaepkfidiiinegdsyllpgnvphspvrfadtvgivveqdrpggend
kirwycshcrqvvheselqmldlgtqvkeaildfendvekrtcfhcktlny

SCOP Domain Coordinates for d1zvfb1:

Click to download the PDB-style file with coordinates for d1zvfb1.
(The format of our PDB-style files is described here.)

Timeline for d1zvfb1: