SCOPe 2.08: Domain d1zvfb2: 1zvf B:1-171

Lineage for d1zvfb2 (1zvf B:1-171)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (30 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187242] (1 PDB entry)

8. Domain d1zvfb2: 1zvf B:1-171 [146030]
   Other proteins in same PDB: d1zvfa1, d1zvfa2, d1zvfb3
   automated match to d1yfua1
   complexed with ni

Details for d1zvfb2

PDB Entry: 1zvf, 2.41 Å

PDB Description: the crystal structure of 3-hydroxyanthranilate 3,4-dioxygenase from saccharomyces cerevisiae

PDB Compounds: (B:) 3-hydroxyanthranilate 3,4-dioxygenase

SCOPe Domain Sequences for d1zvfb2:

Sequence; same for both SEQRES and ATOM records:

>d1zvfb2 b.82.1.0 (B:1-171) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mfnttpinidkwlkenegllkppvnnyclhkggftvmivggpnertdyhinptpewfyqk
kgsmllkvvdetdaepkfidiiinegdsyllpgnvphspvrfadtvgivveqdrpggend
kirwycshcrqvvheselqmldlgtqvkeaildfendvekrtcfhcktlny

Timeline for d1zvfb2:

• d1zvfb2 first appeared in SCOP 1.75, called d1zvfb1
  
• d1zvfb2 appears in SCOPe 2.07