![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (11 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (23 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calmodulin [47516] (11 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47517] (38 PDB entries) Uniprot P02593 |
![]() | Domain d1zuza1: 1zuz A:4-148 [146028] automatically matched to d2bbma_ complexed with ca; mutant |
PDB Entry: 1zuz (more details), 1.91 Å
SCOP Domain Sequences for d1zuza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zuza1 a.39.1.5 (A:4-148) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti dfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevde mireadidgdgqvnyeefvqmmtak
Timeline for d1zuza1: