SCOPe 2.01: Domain d1zu1a2: 1zu1 A:74-128

Lineage for d1zu1a2 (1zu1 A:74-128)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families)

5. Family g.37.1.4: HkH motif-containing C2H2 finger [111436] (4 proteins)
   putative dsRNA-specific zinc finger with a helix-kink-helix (HkH) motif; the kink results from the incompatibility of the cation-coordinating H-x5-H motif with a regular alpha-helix and contributes to RNA recognition

6. Protein dsRNA-binding protein ZFa (ZNF346, JAZ) [161154] (1 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [161155] (1 PDB entry)
   Uniprot Q8AVN9 2-73!Uniprot Q8AVN9 74-128

8. Domain d1zu1a2: 1zu1 A:74-128 [146027]
   complexed with zn

Details for d1zu1a2

PDB Entry: 1zu1

PDB Description: solution structure of the n-terminal zinc fingers of the xenopus laevis double stranded rna binding protein zfa

PDB Compounds: (A:) RNA binding protein ZFa

SCOPe Domain Sequences for d1zu1a2:

Sequence; same for both SEQRES and ATOM records:

>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
svpakkfkaapaeisdgedrskccpvcnmtfsspvvaeshyigkthiknlrlreq

Timeline for d1zu1a2:

• d1zu1a2 first appeared in SCOP 1.75
  
• d1zu1a2 appears in SCOPe 2.02
  
• d1zu1a2 appears in the current release, SCOPe 2.08