Class g: Small proteins [56992] (90 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) |
Family g.37.1.4: HkH motif-containing C2H2 finger [111436] (4 proteins) putative dsRNA-specific zinc finger with a helix-kink-helix (HkH) motif; the kink results from the incompatibility of the cation-coordinating H-x5-H motif with a regular alpha-helix and contributes to RNA recognition |
Protein dsRNA-binding protein ZFa (ZNF346, JAZ) [161154] (1 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [161155] (1 PDB entry) Uniprot Q8AVN9 2-73!Uniprot Q8AVN9 74-128 |
Domain d1zu1a1: 1zu1 A:2-73 [146026] complexed with zn |
PDB Entry: 1zu1 (more details)
SCOP Domain Sequences for d1zu1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} adefgngdaldlpvgkdavnslirenshifsdtqckvcsavlisesqklahyqsrkhank vrrymainqged
Timeline for d1zu1a1: