Lineage for d1zu1a1 (1zu1 A:2-73)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035498Family g.37.1.4: HkH motif-containing C2H2 finger [111436] (4 proteins)
    putative dsRNA-specific zinc finger with a helix-kink-helix (HkH) motif; the kink results from the incompatibility of the cation-coordinating H-x5-H motif with a regular alpha-helix and contributes to RNA recognition
  6. 3035499Protein dsRNA-binding protein ZFa (ZNF346, JAZ) [161154] (1 species)
  7. 3035500Species African clawed frog (Xenopus laevis) [TaxId:8355] [161155] (1 PDB entry)
    Uniprot Q8AVN9 2-73!Uniprot Q8AVN9 74-128
  8. 3035501Domain d1zu1a1: 1zu1 A:2-73 [146026]
    complexed with zn

Details for d1zu1a1

PDB Entry: 1zu1 (more details)

PDB Description: solution structure of the n-terminal zinc fingers of the xenopus laevis double stranded rna binding protein zfa
PDB Compounds: (A:) RNA binding protein ZFa

SCOPe Domain Sequences for d1zu1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
adefgngdaldlpvgkdavnslirenshifsdtqckvcsavlisesqklahyqsrkhank
vrrymainqged

SCOPe Domain Coordinates for d1zu1a1:

Click to download the PDB-style file with coordinates for d1zu1a1.
(The format of our PDB-style files is described here.)

Timeline for d1zu1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zu1a2