SCOPe 2.08: Domain d1zo2b_: 1zo2 B:

Lineage for d1zo2b_ (1zo2 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:5807] [187280] (1 PDB entry)

8. Domain d1zo2b_: 1zo2 B: [146022]
   Other proteins in same PDB: d1zo2a1
   automated match to d1gy7b_

Details for d1zo2b_

PDB Entry: 1zo2, 1.6 Å

PDB Description: structure of nuclear transport factor 2 (ntf2) from cryptosporidium parvum

PDB Compounds: (B:) nuclear transport factor 2

SCOPe Domain Sequences for d1zo2b_:

Sequence; same for both SEQRES and ATOM records:

>d1zo2b_ d.17.4.0 (B:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
sinlnpqfdqigkqfvqhyyqtfqtnrpalgglygpqsmltwedtqfqgqanivnkfnsl
nfqrvqfeitrvdcqpspnngsivfvtgdvriddgqplkfsqvfnlmpsgnggfmifndl
frln

Timeline for d1zo2b_:

• d1zo2b_ first appeared in SCOP 1.75, called d1zo2b1
  
• d1zo2b_ appears in SCOPe 2.07