SCOPe 2.07: Domain d1zo2a1: 1zo2 A:10-126

Lineage for d1zo2a1 (1zo2 A:10-126)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (6 proteins)

6. Protein Nuclear transport factor-2 (NTF2) [54432] (4 species)

7. Species Cryptosporidium parvum [TaxId:5807] [159958] (1 PDB entry)
   Uniprot Q5CQI4 4-127

8. Domain d1zo2a1: 1zo2 A:10-126 [146021]
   Other proteins in same PDB: d1zo2b_

Details for d1zo2a1

PDB Entry: 1zo2, 1.6 Å

PDB Description: structure of nuclear transport factor 2 (ntf2) from cryptosporidium parvum

PDB Compounds: (A:) nuclear transport factor 2

SCOPe Domain Sequences for d1zo2a1:

Sequence; same for both SEQRES and ATOM records:

>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]}
fdqigkqfvqhyyqtfqtnrpalgglygpqsmltwedtqfqgqanivnkfnslnfqrvqf
eitrvdcqpspnngsivfvtgdvriddgqplkfsqvfnlmpsgnggfmifndlfrln

Timeline for d1zo2a1:

• d1zo2a1 first appeared in SCOP 1.75
  
• d1zo2a1 appears in SCOPe 2.06
  
• d1zo2a1 appears in the current release, SCOPe 2.08