SCOPe 2.04: Domain d1zl1a2: 1zl1 A:240-307

Lineage for d1zl1a2 (1zl1 A:240-307)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Sheep (Ovis aries) [TaxId:9940] [109621] (11 PDB entries)
   Uniprot Q6TMG6

8. Domain d1zl1a2: 1zl1 A:240-307 [146020]
   Other proteins in same PDB: d1zl1a1
   automatically matched to d1ljya2

Details for d1zl1a2

PDB Entry: 1zl1, 3.5 Å

PDB Description: crystal structure of the complex of signalling protein from sheep (sps-40) with a designed peptide trp-his-trp reveals significance of asn79 and trp191 in the complex formation

PDB Compounds: (A:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1zl1a2:

Sequence; same for both SEQRES and ATOM records:

>d1zl1a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d1zl1a2:

• d1zl1a2 first appeared in SCOP 1.75
  
• d1zl1a2 appears in SCOPe 2.03
  
• d1zl1a2 appears in SCOPe 2.05
  
• d1zl1a2 appears in the current release, SCOPe 2.08