Lineage for d1zj9b3 (1zj9 B:407-555)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977656Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2977657Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2977658Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)
  6. 2977733Protein Sulfite reductase NirA [160770] (1 species)
  7. 2977734Species Mycobacterium tuberculosis [TaxId:1773] [160771] (2 PDB entries)
    Uniprot P71753 162-326! Uniprot P71753 407-555
  8. 2977737Domain d1zj9b3: 1zj9 B:407-555 [146017]
    Other proteins in same PDB: d1zj9a1, d1zj9a2, d1zj9b1, d1zj9b2
    automated match to d1zj8a3
    complexed with cl, sf4, srm

Details for d1zj9b3

PDB Entry: 1zj9 (more details), 2.9 Å

PDB Description: Structure of Mycobacterium tuberculosis NirA protein
PDB Compounds: (B:) Probable ferredoxin-dependent nitrite reductase NirA

SCOPe Domain Sequences for d1zj9b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zj9b3 d.134.1.1 (B:407-555) Sulfite reductase NirA {Mycobacterium tuberculosis [TaxId: 1773]}
pshwrrnlmacsgiefcklsfaetrvraqhlvpelerrledinsqldvpitvningcpns
cariqiadigfkgqmiddghggsvegfqvhlgghlgldagfgrklrqhkvtsdelgdyid
rvvrnfvkhrsegerfaqwviraeeddlr

SCOPe Domain Coordinates for d1zj9b3:

Click to download the PDB-style file with coordinates for d1zj9b3.
(The format of our PDB-style files is described here.)

Timeline for d1zj9b3: