Lineage for d1zj9a1 (1zj9 A:327-406)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955424Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955425Family d.58.36.1: Duplicated SiR/NiR-like domains 1 and 3 [55125] (5 proteins)
  6. 2955432Protein Sulfite reductase NirA, C-terminal domain [419047] (1 species)
  7. 2955433Species Mycobacterium tuberculosis [TaxId:1773] [419534] (2 PDB entries)
    Uniprot P71753
  8. 2955434Domain d1zj9a1: 1zj9 A:327-406 [146011]
    Other proteins in same PDB: d1zj9a2, d1zj9a3, d1zj9a4, d1zj9b2, d1zj9b3, d1zj9b4
    automated match to d1zj8a1
    complexed with cl, sf4, srm

Details for d1zj9a1

PDB Entry: 1zj9 (more details), 2.9 Å

PDB Description: Structure of Mycobacterium tuberculosis NirA protein
PDB Compounds: (A:) Probable ferredoxin-dependent nitrite reductase NirA

SCOPe Domain Sequences for d1zj9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zj9a1 d.58.36.1 (A:327-406) Sulfite reductase NirA, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
hpidhvgvqrlknglnavgvapiagrvsgtiltavadlmaragsdrirftpyqklvildi
pdallddliagldalglqsr

SCOPe Domain Coordinates for d1zj9a1:

Click to download the PDB-style file with coordinates for d1zj9a1.
(The format of our PDB-style files is described here.)

Timeline for d1zj9a1: