| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) ![]() duplication: contains two subdomains of this fold |
| Family d.58.36.1: Duplicated SiR/NiR-like domains 1 and 3 [55125] (5 proteins) |
| Protein Sulfite reductase NirA, C-terminal domain [419047] (1 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [419534] (2 PDB entries) Uniprot P71753 |
| Domain d1zj9a1: 1zj9 A:327-406 [146011] Other proteins in same PDB: d1zj9a2, d1zj9a3, d1zj9a4, d1zj9b2, d1zj9b3, d1zj9b4 automated match to d1zj8a1 complexed with cl, sf4, srm |
PDB Entry: 1zj9 (more details), 2.9 Å
SCOPe Domain Sequences for d1zj9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zj9a1 d.58.36.1 (A:327-406) Sulfite reductase NirA, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
hpidhvgvqrlknglnavgvapiagrvsgtiltavadlmaragsdrirftpyqklvildi
pdallddliagldalglqsr
Timeline for d1zj9a1:
View in 3DDomains from other chains: (mouse over for more information) d1zj9b1, d1zj9b2, d1zj9b3, d1zj9b4 |