Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (2 families) duplication: contains two subdomains of this fold |
Family d.58.36.1: Duplicated SiR/NiR-like domains 1 and 3 [55125] (3 proteins) |
Protein Sulfite reductase NirA [160334] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [160335] (2 PDB entries) Uniprot P71753 10-161! Uniprot P71753 327-406 |
Domain d1zj8b2: 1zj8 B:10-161 [146008] Other proteins in same PDB: d1zj8a3, d1zj8a4, d1zj8b3, d1zj8b4 automatically matched to 1ZJ8 A:10-161 complexed with cl, sf4, srm |
PDB Entry: 1zj8 (more details), 2.8 Å
SCOPe Domain Sequences for d1zj8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zj8b2 d.58.36.1 (B:10-161) Sulfite reductase NirA {Mycobacterium tuberculosis [TaxId: 1773]} rnegqwalghreplnaneelkkagnpldvrerieniyakqgfdsidktdlrgrfrwwgly tqreqgydgtwtgddnidkleakyfmmrvrcdggalsaaalrtlgqistefardtadisd rqnvqyhwievenvpeiwrrlddvglqtteac
Timeline for d1zj8b2:
View in 3D Domains from other chains: (mouse over for more information) d1zj8a1, d1zj8a2, d1zj8a3, d1zj8a4 |