SCOP 1.75: Domain d1zj8a4: 1zj8 A:162-326

Lineage for d1zj8a4 (1zj8 A:162-326)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
   beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2

4. Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (1 family)
   duplication: contains two domains of this fold

5. Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)

6. Protein Sulfite reductase NirA [160770] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [160771] (2 PDB entries)
   Uniprot P71753 162-326! Uniprot P71753 407-555

8. Domain d1zj8a4: 1zj8 A:162-326 [146006]
   Other proteins in same PDB: d1zj8a1, d1zj8a2, d1zj8b1, d1zj8b2
   complexed with cl, sf4, srm

Details for d1zj8a4

PDB Entry: 1zj8, 2.8 Å

PDB Description: structure of mycobacterium tuberculosis nira protein

PDB Compounds: (A:) Probable ferredoxin-dependent nitrite reductase NirA

SCOP Domain Sequences for d1zj8a4:

Sequence; same for both SEQRES and ATOM records:

>d1zj8a4 d.134.1.1 (A:162-326) Sulfite reductase NirA {Mycobacterium tuberculosis [TaxId: 1773]}
gdcprvvlgsplagesldevldptwaieeivrryigkpdfadlprkyktaisglqdvahe
indvafigvnhpehgpgldlwvggglstnpmlaqrvgawvplgevpevwaavtsvfrdyg
yrrlrakarlkflikdwgiakfrevleteylkrplidgpapepvk

Timeline for d1zj8a4:

• d1zj8a4 is new in SCOP 1.75
  
• d1zj8a4 appears in SCOPe 2.01
  
• d1zj8a4 appears in the current release, SCOPe 2.08