SCOPe 2.06: Domain d1zhoa1: 1zho A:5-228

Lineage for d1zhoa1 (1zho A:5-228)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
   2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)

4. Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family)
   automatically mapped to Pfam PF00687

5. Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)

6. Protein Ribosomal protein L1 [56810] (4 species)

7. Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)

8. Domain d1zhoa1: 1zho A:5-228 [145999]
   automatically matched to 1YL3 C:5-228
   protein/RNA complex; complexed with k

Details for d1zhoa1

PDB Entry: 1zho, 2.6 Å

PDB Description: The structure of a ribosomal protein L1 in complex with mRNA

PDB Compounds: (A:) 50s ribosomal protein l1

SCOPe Domain Sequences for d1zhoa1:

Sequence; same for both SEQRES and ATOM records:

>d1zhoa1 e.24.1.1 (A:5-228) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl
phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg
sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppek
ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs

Timeline for d1zhoa1:

• d1zhoa1 first appeared in SCOP 1.75
  
• d1zhoa1 appears in SCOPe 2.05
  
• d1zhoa1 appears in SCOPe 2.07
  
• d1zhoa1 appears in the current release, SCOPe 2.08