Lineage for d1zelb2 (1zel B:83-295)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011752Fold d.377: Rv2827c C-terminal domain-like [160886] (1 superfamily)
    multihelical array flanked by two three-stranded mixed beta-sheets
  4. 3011753Superfamily d.377.1: Rv2827c C-terminal domain-like [160887] (1 family) (S)
  5. 3011754Family d.377.1.1: Rv2827c C-terminal domain-like [160888] (1 protein)
    the C-terminal part (~210 residues) of Pfam PF09407; DUF2005
  6. 3011755Protein Hypothetical protein Rv2827c [160889] (1 species)
  7. 3011756Species Mycobacterium tuberculosis [TaxId:1773] [160890] (1 PDB entry)
    Uniprot P71625 83-294
  8. 3011758Domain d1zelb2: 1zel B:83-295 [145997]
    Other proteins in same PDB: d1zela1, d1zela3, d1zelb1, d1zelb3
    automated match to d1zela2
    complexed with act, fmt, mpd, na

Details for d1zelb2

PDB Entry: 1zel (more details), 1.93 Å

PDB Description: crystal structure of rv2827c protein from mycobacterium tuberculosis
PDB Compounds: (B:) hypothetical protein Rv2827c

SCOPe Domain Sequences for d1zelb2:

Sequence, based on SEQRES records: (download)

>d1zelb2 d.377.1.1 (B:83-295) Hypothetical protein Rv2827c {Mycobacterium tuberculosis [TaxId: 1773]}
pylplrswlardqnagfmlagasaawhlgyldrqpdgripiwlppakrlpdglasyvsvv
ripwnaadtallaprpallvrrrldlvawatglpalgpeallvqiatrpasfgpwadlvp
hlddlvadcsderlerllsgrptsawqrasylldsggepargqallakrhtevmpvtrft
tahsrdrgesvwapeyqlvdelvvpllrvigka

Sequence, based on observed residues (ATOM records): (download)

>d1zelb2 d.377.1.1 (B:83-295) Hypothetical protein Rv2827c {Mycobacterium tuberculosis [TaxId: 1773]}
pylplrswlardqnagfmlagasaawhlgyldrqpdgripiwlppakrlpdglasyvsvv
ripwnaadtallaprpallvrrrldlvawatglpalgpeallvqiatrpasfgpwadlvp
hlddlvadcsderlerllsgrptsawqrasylldsggepargqallakrhtevmpvtrft
tahsgesvwapeyqlvdelvvpllrvigka

SCOPe Domain Coordinates for d1zelb2:

Click to download the PDB-style file with coordinates for d1zelb2.
(The format of our PDB-style files is described here.)

Timeline for d1zelb2: