SCOPe 2.05: Domain d1zbka1: 1zbk A:1-239,A:308-362

Lineage for d1zbka1 (1zbk A:1-239,A:308-362)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
   secreted during involution

7. Species Sheep (Ovis aries) [TaxId:9940] [109611] (11 PDB entries)
   Uniprot Q6TMG6

8. Domain d1zbka1: 1zbk A:1-239,A:308-362 [145992]
   Other proteins in same PDB: d1zbka2
   automatically matched to d1ljya1
   complexed with nag

Details for d1zbka1

PDB Entry: 1zbk, 2.9 Å

PDB Description: recognition of specific peptide sequences by signalling protein from sheep mammary gland (sps-40): crystal structure of the complex of sps-40 with a peptide trp-pro-trp at 2.9a resolution

PDB Compounds: (A:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1zbka1:

Sequence; same for both SEQRES and ATOM records:

>d1zbka1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlaev

Timeline for d1zbka1:

• d1zbka1 first appeared in SCOP 1.75
  
• d1zbka1 appears in SCOPe 2.04
  
• d1zbka1 appears in SCOPe 2.06
  
• d1zbka1 appears in the current release, SCOPe 2.08