Lineage for d1zbka1 (1zbk A:1-239,A:308-362)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 971115Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 971285Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 971312Species Sheep (Ovis aries) [TaxId:9940] [109611] (12 PDB entries)
    Uniprot Q6TMG6
  8. 971323Domain d1zbka1: 1zbk A:1-239,A:308-362 [145992]
    Other proteins in same PDB: d1zbka2
    automatically matched to d1ljya1
    complexed with nag

Details for d1zbka1

PDB Entry: 1zbk (more details), 2.9 Å

PDB Description: recognition of specific peptide sequences by signalling protein from sheep mammary gland (sps-40): crystal structure of the complex of sps-40 with a peptide trp-pro-trp at 2.9a resolution
PDB Compounds: (A:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1zbka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbka1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlaev

SCOPe Domain Coordinates for d1zbka1:

Click to download the PDB-style file with coordinates for d1zbka1.
(The format of our PDB-style files is described here.)

Timeline for d1zbka1: