Lineage for d1zbca2 (1zbc A:240-307)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857703Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 857704Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 857844Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 857866Species Pig (Sus scrofa) [TaxId:9823] [117869] (4 PDB entries)
    Uniprot Q5UC99
  8. 857868Domain d1zbca2: 1zbc A:240-307 [145991]
    Other proteins in same PDB: d1zbca1
    automatically matched to d1owqa2
    complexed with nag

Details for d1zbca2

PDB Entry: 1zbc (more details), 2.29 Å

PDB Description: crystal structure of the porcine signalling protein liganded with the peptide trp-pro-trp (wpw) at 2.3 a resolution
PDB Compounds: (A:) signal processing protein

SCOP Domain Sequences for d1zbca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbca2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]}
fgksftlassktdvgapvsgpgipgqftkekgilayyeicdflqgatthrfrdqqvpyat
kgnqwvay

SCOP Domain Coordinates for d1zbca2:

Click to download the PDB-style file with coordinates for d1zbca2.
(The format of our PDB-style files is described here.)

Timeline for d1zbca2: