Lineage for d1zbca1 (1zbc A:1-239,A:308-361)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1146554Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1146724Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 1146747Species Pig (Sus scrofa) [TaxId:9823] [117369] (4 PDB entries)
    Uniprot Q5UC99
  8. 1146749Domain d1zbca1: 1zbc A:1-239,A:308-361 [145990]
    Other proteins in same PDB: d1zbca2
    automatically matched to d1owqa1

Details for d1zbca1

PDB Entry: 1zbc (more details), 2.29 Å

PDB Description: crystal structure of the porcine signalling protein liganded with the peptide trp-pro-trp (wpw) at 2.3 a resolution
PDB Compounds: (A:) signal processing protein

SCOPe Domain Sequences for d1zbca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbca1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnfgpqrfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgqedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlar

SCOPe Domain Coordinates for d1zbca1:

Click to download the PDB-style file with coordinates for d1zbca1.
(The format of our PDB-style files is described here.)

Timeline for d1zbca1: