SCOPe 2.08: Domain d1zbca1: 1zbc A:1-239,A:308-361

Lineage for d1zbca1 (1zbc A:1-239,A:308-361)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
   secreted during involution

7. Species Pig (Sus scrofa) [TaxId:9823] [117369] (4 PDB entries)
   Uniprot Q5UC99

8. Domain d1zbca1: 1zbc A:1-239,A:308-361 [145990]
   Other proteins in same PDB: d1zbca2
   automatically matched to d1owqa1

Details for d1zbca1

PDB Entry: 1zbc, 2.29 Å

PDB Description: crystal structure of the porcine signalling protein liganded with the peptide trp-pro-trp (wpw) at 2.3 a resolution

PDB Compounds: (A:) signal processing protein

SCOPe Domain Sequences for d1zbca1:

Sequence; same for both SEQRES and ATOM records:

>d1zbca1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnfgpqrfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgqedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlar

Timeline for d1zbca1:

• d1zbca1 first appeared in SCOP 1.75
  
• d1zbca1 appears in SCOPe 2.07