| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H3 [47122] (6 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (41 PDB entries) |
| Domain d1zbbe1: 1zbb E:39-135 [145988] Other proteins in same PDB: d1zbbb1, d1zbbd1, d1zbbf1 automatically matched to d1p3ie_ protein/DNA complex |
PDB Entry: 1zbb (more details), 9 Å
SCOPe Domain Sequences for d1zbbe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zbbe1 a.22.1.1 (E:39-135) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
hryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeasea
ylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1zbbe1:
View in 3DDomains from other chains: (mouse over for more information) d1zbba1, d1zbbb1, d1zbbd1, d1zbbf1 |