| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2B [47119] (6 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (26 PDB entries) |
| Domain d1zbbd1: 1zbb D:8-122 [145987] Other proteins in same PDB: d1zbba1, d1zbbb1, d1zbbe1, d1zbbf1 automatically matched to d1kx5d_ |
PDB Entry: 1zbb (more details), 9 Å
SCOP Domain Sequences for d1zbbd1:
Sequence, based on SEQRES records: (download)
>d1zbbd1 a.22.1.1 (D:8-122) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvf
eriageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkytsak
>d1zbbd1 a.22.1.1 (D:8-122) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kkgskkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageas
rlahynkrstitsreiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d1zbbd1:
View in 3DDomains from other chains: (mouse over for more information) d1zbba1, d1zbbb1, d1zbbe1, d1zbbf1 |