Lineage for d1zbbd1 (1zbb D:8-122)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698177Protein Histone H2B [47119] (6 species)
  7. 2698178Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (42 PDB entries)
  8. 2698261Domain d1zbbd1: 1zbb D:8-122 [145987]
    Other proteins in same PDB: d1zbba1, d1zbbb1, d1zbbe1, d1zbbf1
    automatically matched to d1kx5d_
    protein/DNA complex

Details for d1zbbd1

PDB Entry: 1zbb (more details), 9 Å

PDB Description: Structure of the 4_601_167 Tetranucleosome
PDB Compounds: (D:) Histone H2B.1

SCOPe Domain Sequences for d1zbbd1:

Sequence, based on SEQRES records: (download)

>d1zbbd1 a.22.1.1 (D:8-122) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvf
eriageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkytsak

Sequence, based on observed residues (ATOM records): (download)

>d1zbbd1 a.22.1.1 (D:8-122) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kkgskkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageas
rlahynkrstitsreiqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d1zbbd1:

Click to download the PDB-style file with coordinates for d1zbbd1.
(The format of our PDB-style files is described here.)

Timeline for d1zbbd1: