Lineage for d1zbba1 (1zbb A:39-135)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2310258Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 2310460Protein Histone H3 [47122] (6 species)
  7. 2310461Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 2310539Domain d1zbba1: 1zbb A:39-135 [145985]
    Other proteins in same PDB: d1zbbb1, d1zbbd1, d1zbbf1
    automatically matched to d1p3ie_
    protein/DNA complex

Details for d1zbba1

PDB Entry: 1zbb (more details), 9 Å

PDB Description: Structure of the 4_601_167 Tetranucleosome
PDB Compounds: (A:) histone h3

SCOPe Domain Sequences for d1zbba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbba1 a.22.1.1 (A:39-135) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
hryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeasea
ylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d1zbba1:

Click to download the PDB-style file with coordinates for d1zbba1.
(The format of our PDB-style files is described here.)

Timeline for d1zbba1: