SCOPe 2.06: Domain d1zb5a2: 1zb5 A:240-307

Lineage for d1zb5a2 (1zb5 A:240-307)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Pig (Sus scrofa) [TaxId:9823] [117869] (4 PDB entries)
   Uniprot Q5UC99

8. Domain d1zb5a2: 1zb5 A:240-307 [145984]
   Other proteins in same PDB: d1zb5a1
   automatically matched to d1owqa2

Details for d1zb5a2

PDB Entry: 1zb5, 2.45 Å

PDB Description: recognition of peptide ligands by signalling protein from porcine mammary gland (spp-40): crystal structure of the complex of spp-40 with a peptide trp-pro-trp at 2.45a resolution

PDB Compounds: (A:) signal processing protein

SCOPe Domain Sequences for d1zb5a2:

Sequence; same for both SEQRES and ATOM records:

>d1zb5a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]}
fgksftlassktdvgapvsgpgipgqftkekgilayyeicdflqgatthrfrdqqvpyat
kgnqwvay

Timeline for d1zb5a2:

• d1zb5a2 first appeared in SCOP 1.75
  
• d1zb5a2 appears in SCOPe 2.05
  
• d1zb5a2 appears in SCOPe 2.07
  
• d1zb5a2 appears in the current release, SCOPe 2.08