Lineage for d1zb5a2 (1zb5 A:240-307)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941865Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2941866Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2942022Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 2942051Species Pig (Sus scrofa) [TaxId:9823] [117869] (4 PDB entries)
    Uniprot Q5UC99
  8. 2942054Domain d1zb5a2: 1zb5 A:240-307 [145984]
    Other proteins in same PDB: d1zb5a1
    automatically matched to d1owqa2

Details for d1zb5a2

PDB Entry: 1zb5 (more details), 2.45 Å

PDB Description: recognition of peptide ligands by signalling protein from porcine mammary gland (spp-40): crystal structure of the complex of spp-40 with a peptide trp-pro-trp at 2.45a resolution
PDB Compounds: (A:) signal processing protein

SCOPe Domain Sequences for d1zb5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zb5a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]}
fgksftlassktdvgapvsgpgipgqftkekgilayyeicdflqgatthrfrdqqvpyat
kgnqwvay

SCOPe Domain Coordinates for d1zb5a2:

Click to download the PDB-style file with coordinates for d1zb5a2.
(The format of our PDB-style files is described here.)

Timeline for d1zb5a2: