![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species) secreted during involution |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [117869] (4 PDB entries) Uniprot Q5UC99 |
![]() | Domain d1zb5a2: 1zb5 A:240-307 [145984] Other proteins in same PDB: d1zb5a1 automatically matched to d1owqa2 |
PDB Entry: 1zb5 (more details), 2.45 Å
SCOPe Domain Sequences for d1zb5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zb5a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]} fgksftlassktdvgapvsgpgipgqftkekgilayyeicdflqgatthrfrdqqvpyat kgnqwvay
Timeline for d1zb5a2: