Lineage for d1zb5a1 (1zb5 A:1-239,A:308-361)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440387Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2440572Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 2440601Species Pig (Sus scrofa) [TaxId:9823] [117369] (4 PDB entries)
    Uniprot Q5UC99
  8. 2440603Domain d1zb5a1: 1zb5 A:1-239,A:308-361 [145983]
    Other proteins in same PDB: d1zb5a2
    automatically matched to d1owqa1

Details for d1zb5a1

PDB Entry: 1zb5 (more details), 2.45 Å

PDB Description: recognition of peptide ligands by signalling protein from porcine mammary gland (spp-40): crystal structure of the complex of spp-40 with a peptide trp-pro-trp at 2.45a resolution
PDB Compounds: (A:) signal processing protein

SCOPe Domain Sequences for d1zb5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zb5a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnfgpqrfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgqedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlar

SCOPe Domain Coordinates for d1zb5a1:

Click to download the PDB-style file with coordinates for d1zb5a1.
(The format of our PDB-style files is described here.)

Timeline for d1zb5a1: