SCOPe 2.08: Domain d1zava1: 1zav A:1-177

Lineage for d1zava1 (1zav A:1-177)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.62: Ribosomal protein L10-like [160369] (1 family)
   consists of globular N-terminal domain, structurally similar to NDK, and the L7/L12-binding C-terminal alpha-helical tail

5. Family d.58.62.1: Ribosomal protein L10-like [160370] (1 protein)
   Pfam PF00466; covers globular domain only

6. Protein Ribosomal protein L10 [160371] (1 species)
   see also (64661) for a partial structure in the ribosome

7. Species Thermotoga maritima [TaxId:2336] [160372] (3 PDB entries)
   Uniprot P29394 1-177

8. Domain d1zava1: 1zav A:1-177 [145962]
   Other proteins in same PDB: d1zava2, d1zavu1, d1zavv1, d1zavw1, d1zavx1, d1zavy1, d1zavz1
   protein/RNA complex

Details for d1zava1

PDB Entry: 1zav, 1.9 Å

PDB Description: Ribosomal Protein L10-L12(NTD) Complex, Space Group P21

PDB Compounds: (A:) 50s ribosomal protein l10

SCOPe Domain Sequences for d1zava1:

Sequence; same for both SEQRES and ATOM records:

>d1zava1 d.58.62.1 (A:1-177) Ribosomal protein L10 {Thermotoga maritima [TaxId: 2336]}
mltrqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvknt
llnlalknaeyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggfleg
kkftaeeveniaklpskeelyamlvgrvkapitglvfalsgilrnlvyvlnaikekk

Timeline for d1zava1:

• d1zava1 first appeared in SCOP 1.75
  
• d1zava1 appears in SCOPe 2.07