SCOP 1.75: Domain d1z96b1: 1z96 B:298-332

Lineage for d1z96b1 (1z96 B:298-332)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (4 families)

5. Family a.5.2.1: UBA domain [46935] (24 proteins)

6. Protein UBA-domain protein mud1 [158356] (1 species)

7. Species Schizosaccharomyces pombe [TaxId:4896] [158357] (1 PDB entry)
   Uniprot Q10256 295-332

8. Domain d1z96b1: 1z96 B:298-332 [145961]
   automatically matched to 1Z96 A:295-332

Details for d1z96b1

PDB Entry: 1z96, 1.8 Å

PDB Description: Crystal structure of the Mud1 UBA domain

PDB Compounds: (B:) UBA-domain protein mud1

SCOP Domain Sequences for d1z96b1:

Sequence; same for both SEQRES and ATOM records:

>d1z96b1 a.5.2.1 (B:298-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]}
skiaqlvsmgfdpleaaqaldaangdldvaasfll

Timeline for d1z96b1:

• d1z96b1 is new in SCOP 1.75
  
• d1z96b1 is called d1z96b_ in SCOPe 2.01
  
• d1z96b1 appears in the current release, SCOPe 2.08, called d1z96b_