![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.2: UBA-like [46934] (5 families) ![]() |
![]() | Family a.5.2.1: UBA domain [46935] (25 proteins) |
![]() | Protein UBA-domain protein mud1 [158356] (1 species) |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158357] (1 PDB entry) Uniprot Q10256 295-332 |
![]() | Domain d1z96b_: 1z96 B: [145961] automated match to d1z96a1 |
PDB Entry: 1z96 (more details), 1.8 Å
SCOPe Domain Sequences for d1z96b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z96b_ a.5.2.1 (B:) UBA-domain protein mud1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} skiaqlvsmgfdpleaaqaldaangdldvaasfll
Timeline for d1z96b_: