Lineage for d1z96b_ (1z96 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308343Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2308367Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2308368Family a.5.2.1: UBA domain [46935] (25 protein domains)
  6. 2308424Protein UBA-domain protein mud1 [158356] (1 species)
  7. 2308425Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158357] (1 PDB entry)
    Uniprot Q10256 295-332
  8. 2308427Domain d1z96b_: 1z96 B: [145961]
    automated match to d1z96a1

Details for d1z96b_

PDB Entry: 1z96 (more details), 1.8 Å

PDB Description: Crystal structure of the Mud1 UBA domain
PDB Compounds: (B:) UBA-domain protein mud1

SCOPe Domain Sequences for d1z96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z96b_ a.5.2.1 (B:) UBA-domain protein mud1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
skiaqlvsmgfdpleaaqaldaangdldvaasfll

SCOPe Domain Coordinates for d1z96b_:

Click to download the PDB-style file with coordinates for d1z96b_.
(The format of our PDB-style files is described here.)

Timeline for d1z96b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1z96a1