Lineage for d1z60a1 (1z60 A:328-386)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037801Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037802Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 3037843Family g.49.1.2: TFIIH p44 subunit cysteine-rich domain [57899] (2 proteins)
  6. 3037844Protein TFIIH p44 subunit cysteine-rich domain [57900] (1 species)
  7. 3037845Species Human (Homo sapiens) [TaxId:9606] [57901] (1 PDB entry)
  8. 3037846Domain d1z60a1: 1z60 A:328-386 [145959]
    complexed with zn

Details for d1z60a1

PDB Entry: 1z60 (more details)

PDB Description: solution structure of the carboxy-terminal domain of human tfiih p44 subunit
PDB Compounds: (A:) TFIIH basal transcription factor complex p44 subunit

SCOPe Domain Sequences for d1z60a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]}
ldafqeipleeyngerfcygcqgelkdqhvyvcavcqnvfcvdcdvfvhdslhscpgci

SCOPe Domain Coordinates for d1z60a1:

Click to download the PDB-style file with coordinates for d1z60a1.
(The format of our PDB-style files is described here.)

Timeline for d1z60a1: